Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.0: automated matches [191651] (1 protein) not a true family |
Protein automated matches [191201] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries) |
Domain d3k7ec_: 3k7e C: [247121] automated match to d4nbla_ |
PDB Entry: 3k7e (more details), 3 Å
SCOPe Domain Sequences for d3k7ec_:
Sequence, based on SEQRES records: (download)
>d3k7ec_ c.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfndl kaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchsl vgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpagadflmcys vaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvdfckdpsaig kkqvpcfasmltkklhffp
>d3k7ec_ c.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfndl kaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchsl vgkpkifiiqtlpagadflmcysvaegyyshretvngswyiqdlcemlgkygssleftel ltlvnrkvsqrrgkkqvpcfasmltkklhffp
Timeline for d3k7ec_: