| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
| Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
| Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) |
| Domain d3jzib2: 3jzi B:115-330 [247083] Other proteins in same PDB: d3jzia1, d3jzia3, d3jzib1, d3jzib3 automated match to d1dv2a3 complexed with jzl |
PDB Entry: 3jzi (more details), 2.31 Å
SCOPe Domain Sequences for d3jzib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jzib2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d3jzib2: