Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (76 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [225651] (2 PDB entries) |
Domain d3jvda_: 3jvd A: [247059] automated match to d2qu7a_ complexed with gol, so4 |
PDB Entry: 3jvd (more details), 2.3 Å
SCOPe Domain Sequences for d3jvda_:
Sequence, based on SEQRES records: (download)
>d3jvda_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} salvgvivpdlsneyyseslqtiqqdlkaagyqmlvaeansvqaqdvvmeslisiqaagi ihvpvvgsiapegipmvqltrgelgpgfprvlcddeagffqltesvlggsgmniaalvge eslsttqermrgishaasiygaevtfhfghysvesgeemaqvvfnnglpdalivasprlm agvmraftrlnvrvphdvviggyddpewysfvgagittfvppheemgkeavrllvdlien pelptgdvvlqgqvilrgssth
>d3jvda_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} salvgvivpdlsneyyseslqtiqqdlkaagyqmlvaeansvqaqdvvmeslisiqaagi ihvpvvgsiaegipmvqltrpgfprvlcddeagffqltesvlggsgmniaalvgeeslst tqermrgishaasiygaevtfhfghysvesgeemaqvvfnnglpdalivasprlmagvmr aftrlnvrvphdvviggyddpewysfvgagittfvppheemgkeavrllvdlienpetgd vvlqgqvilrgssth
Timeline for d3jvda_: