Class b: All beta proteins [48724] (178 folds) |
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) |
Family b.105.1.0: automated matches [231757] (1 protein) not a true family |
Protein automated matches [231758] (5 species) not a true protein |
Species Escherichia coli [TaxId:562] [232620] (4 PDB entries) |
Domain d3itaa2: 3ita A:259-352 [246951] Other proteins in same PDB: d3itaa1, d3itab1, d3itac1, d3itad1 automated match to d3it9a2 complexed with aic, aix, so4 |
PDB Entry: 3ita (more details), 1.8 Å
SCOPe Domain Sequences for d3itaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3itaa2 b.105.1.0 (A:259-352) automated matches {Escherichia coli [TaxId: 562]} fetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkasytltepqltap lkkgqvvgtidfqlngksieqrplivmenveegg
Timeline for d3itaa2: