Lineage for d3imlc2 (3iml C:116-235)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926950Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1926951Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1927050Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1927051Protein automated matches [254617] (8 species)
    not a true protein
  7. 1927052Species Burkholderia pseudomallei [TaxId:28450] [255893] (1 PDB entry)
  8. 1927060Domain d3imlc2: 3iml C:116-235 [246941]
    automated match to d2p02a2

Details for d3imlc2

PDB Entry: 3iml (more details), 2.35 Å

PDB Description: Crystal Structure Of S-Adenosylmethionine Synthetase From Burkholderia Pseudomallei
PDB Compounds: (C:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d3imlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3imlc2 d.130.1.0 (C:116-235) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
ldqgagdqglmfgyacdetpelmplpihlshrlverqanlrrdgrlpwlrpdaksqvtvr
yvdgkphsidtvvlstqhapeidlpalreavieevikptlpadlikgdikflvnptgrfv

SCOPe Domain Coordinates for d3imlc2:

Click to download the PDB-style file with coordinates for d3imlc2.
(The format of our PDB-style files is described here.)

Timeline for d3imlc2: