Lineage for d3ilag_ (3ila G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543928Superfamily b.42.6: MIR domain [82109] (3 families) (S)
  5. 1543936Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins)
    Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5
  6. 1543940Protein N-terminal domain of ryanodine receptor type 1 [254405] (1 species)
  7. 1543941Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [254841] (2 PDB entries)
  8. 1543950Domain d3ilag_: 3ila G: [246928]
    automated match to d3hsma_

Details for d3ilag_

PDB Entry: 3ila (more details), 2.9 Å

PDB Description: Crystal structure of rabbit ryanodine receptor 1 N-terminal domain (9-205)
PDB Compounds: (G:) Ryanodine receptor 1

SCOPe Domain Sequences for d3ilag_:

Sequence, based on SEQRES records: (download)

>d3ilag_ b.42.6.2 (G:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qflrtddevvlqcsatvlkeqlklclaaegfgnrlcfleptsnaqnvppdlaiccftleq
slsvralqemlantveagvessqggghrtllyghaillrhahsrmylsclttsrsmtdkl
afdvglqedatgeacwwtmhpaskqrsegekvrvgddlilvsvsserylhlstasgelqv
dasfmqtlwnmnpi

Sequence, based on observed residues (ATOM records): (download)

>d3ilag_ b.42.6.2 (G:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qflrtddevvlqcsatvlqlklclaaegrlcfleptppdlaiccftleqslsvralqeml
anhrtllyghaillrhahsrmylsclttslafdvglqedatgeacwwtmhpaqrsegekv
rvgddlilvsvsserylhlstgelqvdasfmqtlwnmnpi

SCOPe Domain Coordinates for d3ilag_:

Click to download the PDB-style file with coordinates for d3ilag_.
(The format of our PDB-style files is described here.)

Timeline for d3ilag_: