Lineage for d3ibra3 (3ibr A:310-494)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665377Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1665498Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 1665499Protein automated matches [190838] (10 species)
    not a true protein
  7. 1665511Species Pseudomonas aeruginosa [TaxId:287] [255839] (2 PDB entries)
  8. 1665517Domain d3ibra3: 3ibr A:310-494 [246897]
    Other proteins in same PDB: d3ibra1, d3ibrb1
    automated match to d3nhqa3
    complexed with bla; mutant

Details for d3ibra3

PDB Entry: 3ibr (more details), 2.97 Å

PDB Description: crystal structure of p. aeruginosa bacteriophytochrome photosensory core module mutant q188l in the mixed pr/pfr state
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3ibra3:

Sequence, based on SEQRES records: (download)

>d3ibra3 d.110.2.0 (A:310-494) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqesgwifwfrh
eevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldl
melcl

Sequence, based on observed residues (ATOM records): (download)

>d3ibra3 d.110.2.0 (A:310-494) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirer
qagnvlqrlqrdperdiyhtdnwgdccgvlairfgwifwfrheevhgpsgprltprgsfe
aweevvrghstpwsetdlaiaeklrldlmelcl

SCOPe Domain Coordinates for d3ibra3:

Click to download the PDB-style file with coordinates for d3ibra3.
(The format of our PDB-style files is described here.)

Timeline for d3ibra3: