Lineage for d1btoa1 (1bto A:1-163,A:340-374)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meanderSuperfamily b.35.1: GroES-like [50129] (3 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)Protein Alcohol dehydrogenase [50137] (9 species)
contains a Zn-finger subdomain, residues 94-117Species Horse (Equus caballus) [TaxId:9796] [50138] (52 PDB entries)
Uniprot P00327
Domain d1btoa1: 1bto A:1-163,A:340-374 [24677]
Other proteins in same PDB: d1btoa2, d1btob2, d1btoc2, d1btod2
complexed with nad, ssb, zn
Details for d1btoa1
PDB Entry: 1bto (more details), 2 Å
PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide
PDB Compounds: (A:) liver alcohol dehydrogenaseSCOPe Domain Sequences for d1btoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btoa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf
SCOPe Domain Coordinates for d1btoa1:
Click to download the PDB-style file with coordinates for d1btoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btoa1:
View in 3D
