SCOPe 2.04: Domain d3i9oa_: 3i9o A:

Lineage for d3i9oa_ (3i9o A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein automated matches [191078] (1 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)

8. Domain d3i9oa_: 3i9o A: [246749]
   automated match to d3zwva_
   complexed with avw

Details for d3i9oa_

PDB Entry: 3i9o, 3 Å

PDB Description: Crystal structure of ADP ribosyl cyclase complexed with ribo-2'F-ADP ribose

PDB Compounds: (A:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3i9oa_:

Sequence; same for both SEQRES and ATOM records:

>d3i9oa_ c.23.14.3 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

Timeline for d3i9oa_:

• d3i9oa_ is new in SCOPe 2.04-stable
  
• d3i9oa_ appears in SCOPe 2.05
  
• d3i9oa_ appears in the current release, SCOPe 2.08