| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (78 species) not a true protein |
| Species Ruegeria pomeroyi [TaxId:89184] [255879] (1 PDB entry) |
| Domain d3i6ea2: 3i6e A:133-375 [246728] Other proteins in same PDB: d3i6ea1, d3i6eb1, d3i6ec1, d3i6ed1, d3i6ee1, d3i6ef1, d3i6eg1, d3i6eh1 automated match to d3i6ta2 complexed with mg, na |
PDB Entry: 3i6e (more details), 1.7 Å
SCOPe Domain Sequences for d3i6ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i6ea2 c.1.11.0 (A:133-375) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
kcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpe
frvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesv
ygpedmvraahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlag
thmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehya
vrr
Timeline for d3i6ea2: