Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (3 species) |
Species Escherichia coli [TaxId:562] [49997] (45 PDB entries) Uniprot P00722 |
Domain d3i3ba5: 3i3b A:731-1023 [246653] Other proteins in same PDB: d3i3ba1, d3i3ba2, d3i3ba3, d3i3ba4, d3i3bb1, d3i3bb2, d3i3bb3, d3i3bb4, d3i3bc1, d3i3bc2, d3i3bc3, d3i3bc4, d3i3bd1, d3i3bd2, d3i3bd3, d3i3bd4 automated match to d1jz8a4 complexed with 149, dms, mg, na |
PDB Entry: 3i3b (more details), 2.2 Å
SCOPe Domain Sequences for d3i3ba5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ba5 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3i3ba5:
View in 3D Domains from same chain: (mouse over for more information) d3i3ba1, d3i3ba2, d3i3ba3, d3i3ba4 |