Lineage for d3hw8a2 (3hw8 A:329-385)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1494217Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1494393Protein DNA polymerase lambda [101253] (1 species)
  7. 1494394Species Human (Homo sapiens) [TaxId:9606] [101254] (25 PDB entries)
  8. 1494399Domain d3hw8a2: 3hw8 A:329-385 [246599]
    Other proteins in same PDB: d3hw8a1, d3hw8a3
    automated match to d1xsna2
    protein/DNA complex; complexed with d3t, edo, mg, na

Details for d3hw8a2

PDB Entry: 3hw8 (more details), 1.95 Å

PDB Description: ternary complex of dna polymerase lambda of a two nucleotide gapped dna substrate with a c in the scrunch site
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3hw8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hw8a2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3hw8a2:

Click to download the PDB-style file with coordinates for d3hw8a2.
(The format of our PDB-style files is described here.)

Timeline for d3hw8a2: