Lineage for d3hw3a1 (3hw3 A:1-198)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490599Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2490600Protein PA N-terminal domain [254375] (7 species)
  7. 2490626Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2490635Domain d3hw3a1: 3hw3 A:1-198 [246582]
    Other proteins in same PDB: d3hw3a2, d3hw3b2, d3hw3c2, d3hw3d2
    automated match to d3ebja_
    complexed with mg, u5p

Details for d3hw3a1

PDB Entry: 3hw3 (more details), 1.9 Å

PDB Description: The crystal structure of avian influenza virus PA_N in complex with UMP
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d3hw3a1:

Sequence, based on SEQRES records: (download)

>d3hw3a1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
tiiesgdpnallkhrfeiiegrdrtmawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhtyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrglwdsfrqserge

Sequence, based on observed residues (ATOM records): (download)

>d3hw3a1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysrfeiiegrdrt
mawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankiksekthi
hifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqserge

SCOPe Domain Coordinates for d3hw3a1:

Click to download the PDB-style file with coordinates for d3hw3a1.
(The format of our PDB-style files is described here.)

Timeline for d3hw3a1: