Lineage for d3hl2d_ (3hl2 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504296Family c.67.1.9: SepSecS-like [159704] (2 proteins)
    Pfam PF05889
  6. 2504312Protein automated matches [254680] (1 species)
    not a true protein
  7. 2504313Species Human (Homo sapiens) [TaxId:9606] [255862] (4 PDB entries)
  8. 2504319Domain d3hl2d_: 3hl2 D: [246503]
    automated match to d3bc8a1
    protein/RNA complex; complexed with plr, sep, ts6

Details for d3hl2d_

PDB Entry: 3hl2 (more details), 2.81 Å

PDB Description: the crystal structure of the human sepsecs-trnasec complex
PDB Compounds: (D:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d3hl2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hl2d_ c.67.1.9 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
earrshehlirlllekgkcpengwdestlelflhelaimdsnnflgncgvgeregrvasa
lvarrhyrfihgigrsgdisavqpkaagssllnkitnslvldiiklagvhtvancfvvpm
atgmsltlcfltlrhkrpkakyiiwpridqkscfksmitagfepvvienvlegdelrtdl
kaveakvqelgpdcilcihsttscfaprvpdrleelavicanydiphivnnaygvqsskc
mhliqqgarvgridafvqsldknfmvpvggaiiagfndsfiqeiskmypgrasaspsldv
litllslgsngykkllkerkemfsylsnqikklseaynerllhtphnpislamtlktlde
hrdkavtqlgsmlftrqvsgarvvplgsmqtvsgytfrgfmshtnnypcaylnaasaigm
kmqdvdlfikrldrclkavrk

SCOPe Domain Coordinates for d3hl2d_:

Click to download the PDB-style file with coordinates for d3hl2d_.
(The format of our PDB-style files is described here.)

Timeline for d3hl2d_: