SCOPe 2.08: Domain d3h78a2: 3h78 A:177-329

Lineage for d3h78a2 (3h78 A:177-329)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [227637] (5 PDB entries)

8. Domain d3h78a2: 3h78 A:177-329 [246483]
   Other proteins in same PDB: d3h78b3
   complexed with be2; mutant

Details for d3h78a2

PDB Entry: 3h78, 1.7 Å

PDB Description: crystal structure of pseudomonas aeruginosa pqsd c112a mutant in complex with anthranilic acid

PDB Compounds: (A:) PQS biosynthetic enzyme

SCOPe Domain Sequences for d3h78a2:

Sequence; same for both SEQRES and ATOM records:

>d3h78a2 c.95.1.0 (A:177-329) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glldlrlgadgnyfdllmtaapgsasptfldenvlregggeflmrgrpmfehasqtlvri
agemlaaheltlddidhvichqpnlrildavqeqlgipqhkfavtvdrlgnmasastpvt
lamfwpdiqpgqrvlvltygsgatwgaalyrkp

Timeline for d3h78a2:

• d3h78a2 first appeared in SCOPe 2.04
  
• d3h78a2 appears in SCOPe 2.07