Lineage for d3h78b2 (3h78 B:177-329)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918132Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [227637] (5 PDB entries)
  8. 2918136Domain d3h78b2: 3h78 B:177-329 [246485]
    Other proteins in same PDB: d3h78b3
    complexed with be2; mutant

Details for d3h78b2

PDB Entry: 3h78 (more details), 1.7 Å

PDB Description: crystal structure of pseudomonas aeruginosa pqsd c112a mutant in complex with anthranilic acid
PDB Compounds: (B:) PQS biosynthetic enzyme

SCOPe Domain Sequences for d3h78b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h78b2 c.95.1.0 (B:177-329) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glldlrlgadgnyfdllmtaapgsasptfldenvlregggeflmrgrpmfehasqtlvri
agemlaaheltlddidhvichqpnlrildavqeqlgipqhkfavtvdrlgnmasastpvt
lamfwpdiqpgqrvlvltygsgatwgaalyrkp

SCOPe Domain Coordinates for d3h78b2:

Click to download the PDB-style file with coordinates for d3h78b2.
(The format of our PDB-style files is described here.)

Timeline for d3h78b2: