Lineage for d3h5qa3 (3h5q A:331-433)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 2945281Species Staphylococcus aureus [TaxId:93062] [255860] (1 PDB entry)
  8. 2945282Domain d3h5qa3: 3h5q A:331-433 [246471]
    Other proteins in same PDB: d3h5qa1, d3h5qa2, d3h5qa4
    automated match to d1brwa3
    complexed with so4, thm

Details for d3h5qa3

PDB Entry: 3h5q (more details), 1.94 Å

PDB Description: crystal structure of a putative pyrimidine-nucleoside phosphorylase from staphylococcus aureus
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d3h5qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5qa3 d.41.3.0 (A:331-433) automated matches {Staphylococcus aureus [TaxId: 93062]}
qaqyqieykakksgyvtelvsndigvasmmlgagrltkeddidlavgivlnkkigdkvee
geslltihsnrqdvddvvkkldssitiadhvvsptlihkiite

SCOPe Domain Coordinates for d3h5qa3:

Click to download the PDB-style file with coordinates for d3h5qa3.
(The format of our PDB-style files is described here.)

Timeline for d3h5qa3: