| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
| Family c.27.1.0: automated matches [254295] (1 protein) not a true family |
| Protein automated matches [254679] (2 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [255859] (1 PDB entry) |
| Domain d3h5qa2: 3h5q A:71-330 [246470] Other proteins in same PDB: d3h5qa1, d3h5qa3, d3h5qa4 automated match to d1brwa2 complexed with so4, thm |
PDB Entry: 3h5q (more details), 1.94 Å
SCOPe Domain Sequences for d3h5qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h5qa2 c.27.1.0 (A:71-330) automated matches {Staphylococcus aureus [TaxId: 93062]}
lsdikgvkvdkhstggvgdtttlvlaplvaavdvpvakmsgrglghtggtidkleaidgf
hveideatfvklvnenkvavvgqsgnltpadkklyalrdvtgtvnsipliassimskkia
agadaivldvktgsgafmktledaealahamvrignnvgrntmaiisdmnqplgraigna
lelqeaidtlkgqgpkdltelvltlgsqmvvlankaetleearallieainsgaalekfk
tfiknqggdetvidhperlp
Timeline for d3h5qa2: