| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein Proteasome-activating nucleotidase PAN, C-terminal domain [346084] (1 species) |
| Species Methanocaldococcus jannaschii [TaxId:2190] [346303] (1 PDB entry) |
| Domain d3h4mb_: 3h4m B: [246465] automated match to d1iy2a_ complexed with adp |
PDB Entry: 3h4m (more details), 3.11 Å
SCOPe Domain Sequences for d3h4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4mb_ c.37.1.20 (B:) Proteasome-activating nucleotidase PAN, C-terminal domain {Methanocaldococcus jannaschii [TaxId: 2190]}
amevderpnvryedigglekqmqeirevvelplkhpelfekvgieppkgillygppgtgk
tllakavatetnatfirvvgselvkkfigegaslvkdifklakekapsiifideidaiaa
krtdaltggdrevqrtlmqllaemdgfdargdvkiigatnrpdildpailrpgrfdriie
vpapdekgrleilkihtrkmnlaedvnleeiakmtegcvgaelkaicteagmnairelrd
yvtmddfrkavekimekkkvk
Timeline for d3h4mb_: