Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [197078] (4 PDB entries) |
Domain d3h1ub_: 3h1u B: [246463] automated match to d4auqc_ complexed with cd |
PDB Entry: 3h1u (more details), 3 Å
SCOPe Domain Sequences for d3h1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1ub_ d.15.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrg
Timeline for d3h1ub_: