Lineage for d3h1hc1 (3h1h C:1-261)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957178Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1957179Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 1957185Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1957240Protein automated matches [196844] (6 species)
    not a true protein
  7. 1957243Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries)
  8. 1957246Domain d3h1hc1: 3h1h C:1-261 [246418]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l75p1
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hc1

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3h1hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hc1 f.21.1.2 (C:1-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
ltlalfspnllgdpenftpan

SCOPe Domain Coordinates for d3h1hc1:

Click to download the PDB-style file with coordinates for d3h1hc1.
(The format of our PDB-style files is described here.)

Timeline for d3h1hc1: