Lineage for d3h1hs_ (3h1h S:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959070Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1959071Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1959072Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1959102Protein automated matches [190325] (4 species)
    not a true protein
  7. 1959111Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 1959115Domain d3h1hs_: 3h1h S: [246434]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d1l0lf_
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hs_

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (S:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d3h1hs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hs_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3h1hs_:

Click to download the PDB-style file with coordinates for d3h1hs_.
(The format of our PDB-style files is described here.)

Timeline for d3h1hs_: