SCOPe 2.04: Domain d3gt9b_: 3gt9 B:

Lineage for d3gt9b_ (3gt9 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
   Uniprot Q96CA5 78-159

8. Domain d3gt9b_: 3gt9 B: [246358]
   automated match to d1oxnb_
   complexed with 516, zn

Details for d3gt9b_

PDB Entry: 3gt9, 1.7 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic

PDB Compounds: (B:) Baculoviral IAP repeat-containing 7

SCOPe Domain Sequences for d3gt9b_:

Sequence, based on SEQRES records:

>d3gt9b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlt

Sequence, based on observed residues (ATOM records):

>d3gt9b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtdkvrcffcygglqswkrgddp
wtehakwfpgcqfllrskgqeyinnihlt

Timeline for d3gt9b_:

• d3gt9b_ is new in SCOPe 2.04-stable
  
• d3gt9b_ appears in SCOPe 2.05
  
• d3gt9b_ appears in the current release, SCOPe 2.08