Lineage for d3gq4a2 (3gq4 A:135-228)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507114Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1507115Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1507190Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 1507191Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 1507192Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)
  8. 1507194Domain d3gq4a2: 3gq4 A:135-228 [246348]
    Other proteins in same PDB: d3gq4a1, d3gq4a3
    automated match to d1r2za1
    protein/DNA complex; complexed with gol, zn

Details for d3gq4a2

PDB Entry: 3gq4 (more details), 1.7 Å

PDB Description: sequence-matched mutm lesion recognition complex 5 (lrc5)
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3gq4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gq4a2 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmkggstvrtyvnt

SCOPe Domain Coordinates for d3gq4a2:

Click to download the PDB-style file with coordinates for d3gq4a2.
(The format of our PDB-style files is described here.)

Timeline for d3gq4a2: