Lineage for d3giqa1 (3giq A:5-60)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428725Family b.92.1.0: automated matches [254292] (1 protein)
    not a true family
  6. 2428726Protein automated matches [254676] (1 species)
    not a true protein
  7. 2428727Species Bordetella bronchiseptica [TaxId:518] [255847] (2 PDB entries)
  8. 2428732Domain d3giqa1: 3giq A:5-60 [246310]
    Other proteins in same PDB: d3giqa2, d3giqb2
    automated match to d1rk6a1
    complexed with g01, zn

Details for d3giqa1

PDB Entry: 3giq (more details), 1.8 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc and phosphonate inhibitor, a mimic of the reaction tetrahedral intermediate.
PDB Compounds: (A:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3giqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3giqa1 b.92.1.0 (A:5-60) automated matches {Bordetella bronchiseptica [TaxId: 518]}
ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivap

SCOPe Domain Coordinates for d3giqa1:

Click to download the PDB-style file with coordinates for d3giqa1.
(The format of our PDB-style files is described here.)

Timeline for d3giqa1: