SCOPe 2.04: Domain d3ga3a_: 3ga3 A:

Lineage for d3ga3a_ (3ga3 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families)
   Pfam PF11648

5. Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)

6. Protein automated matches [254636] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255639] (2 PDB entries)

8. Domain d3ga3a_: 3ga3 A: [246275]
   automated match to d2rqba_
   complexed with zn

Details for d3ga3a_

PDB Entry: 3ga3, 1.45 Å

PDB Description: Crystal structure of the C-terminal domain of human MDA5

PDB Compounds: (A:) Interferon-induced helicase C domain-containing protein 1, MDA5

SCOPe Domain Sequences for d3ga3a_:

Sequence; same for both SEQRES and ATOM records:

>d3ga3a_ b.88.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akhyknnpslitflckncsvlacsgedihviekmhhvnmtpefkelyivrenkalqkkca
dyqingeiickcgqawgtmmvhkgldlpclkirnfvvvfknnstkkqykkwvelpitfpn
ldyselehhhhhh

Timeline for d3ga3a_:

• d3ga3a_ is new in SCOPe 2.04-stable
  
• d3ga3a_ appears in SCOPe 2.05
  
• d3ga3a_ appears in the current release, SCOPe 2.08, called d3ga3a1