![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
![]() | Protein Bacteriophytochrome BphP [160672] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries) Uniprot Q9HWR3 5-117 |
![]() | Domain d3g6ob1: 3g6o B:6-117 [246243] Other proteins in same PDB: d3g6oa2, d3g6oa3, d3g6ob2, d3g6ob3 automated match to d3nhqa1 complexed with bla; mutant |
PDB Entry: 3g6o (more details), 2.85 Å
SCOPe Domain Sequences for d3g6ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g6ob1 d.110.3.9 (B:6-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} pvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqvg pevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt
Timeline for d3g6ob1: