Lineage for d3g6oa2 (3g6o A:118-309)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210555Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2210676Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2210677Protein automated matches [190838] (13 species)
    not a true protein
  7. 2210690Species Pseudomonas aeruginosa [TaxId:287] [255839] (2 PDB entries)
  8. 2210691Domain d3g6oa2: 3g6o A:118-309 [246241]
    Other proteins in same PDB: d3g6oa1, d3g6ob1
    automated match to d3nhqa2
    complexed with bla; mutant

Details for d3g6oa2

PDB Entry: 3g6o (more details), 2.85 Å

PDB Description: crystal structure of p. aeruginosa bacteriophytochrome pabphp photosensory core domain mutant q188l
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3g6oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6oa2 d.110.2.0 (A:118-309) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylglrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

SCOPe Domain Coordinates for d3g6oa2:

Click to download the PDB-style file with coordinates for d3g6oa2.
(The format of our PDB-style files is described here.)

Timeline for d3g6oa2: