Lineage for d3fznc2 (3fzn C:182-341)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121061Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2121103Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 2121104Species Pseudomonas putida [TaxId:303] [52483] (41 PDB entries)
    Uniprot P20906
  8. 2121135Domain d3fznc2: 3fzn C:182-341 [246218]
    Other proteins in same PDB: d3fzna1, d3fzna3, d3fznb1, d3fznb3, d3fznc1, d3fznc3, d3fznd1, d3fznd3
    automated match to d1q6za1
    complexed with cl, d7k, mg, peg, po4

Details for d3fznc2

PDB Entry: 3fzn (more details), 1.62 Å

PDB Description: intermediate analogue in benzoylformate decarboxylase
PDB Compounds: (C:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d3fznc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fznc2 c.31.1.3 (C:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d3fznc2:

Click to download the PDB-style file with coordinates for d3fznc2.
(The format of our PDB-style files is described here.)

Timeline for d3fznc2: