SCOPe 2.07: Domain d3fyyb1: 3fyy B:1-122

Lineage for d3fyyb1 (3fyy B:1-122)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [255837] (3 PDB entries)

8. Domain d3fyyb1: 3fyy B:1-122 [246203]
   Other proteins in same PDB: d3fyya2, d3fyyb2
   automated match to d3sjna1
   complexed with mg

Details for d3fyyb1

PDB Entry: 3fyy, 1.8 Å

PDB Description: crystal structure of divergent enolase from oceanobacillus iheyensis complexed with mg

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3fyyb1:

Sequence; same for both SEQRES and ATOM records:

>d3fyyb1 d.54.1.0 (B:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

Timeline for d3fyyb1:

• d3fyyb1 first appeared in SCOPe 2.04
  
• d3fyyb1 appears in SCOPe 2.06
  
• d3fyyb1 appears in the current release, SCOPe 2.08