Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Oceanobacillus iheyensis [TaxId:221109] [255837] (3 PDB entries) |
Domain d3fyyb1: 3fyy B:1-122 [246203] Other proteins in same PDB: d3fyya2, d3fyyb2 automated match to d3sjna1 complexed with mg |
PDB Entry: 3fyy (more details), 1.8 Å
SCOPe Domain Sequences for d3fyyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyyb1 d.54.1.0 (B:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 221109]} mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl gg
Timeline for d3fyyb1: