Lineage for d3fxoa1 (3fxo A:2-296)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239763Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 2239764Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 2239765Family d.219.1.1: PP2C-like [81605] (3 proteins)
    Pfam PF00481
  6. 2239773Protein automated matches [232201] (1 species)
    not a true protein
  7. 2239774Species Human (Homo sapiens) [TaxId:9606] [232202] (8 PDB entries)
  8. 2239780Domain d3fxoa1: 3fxo A:2-296 [246196]
    Other proteins in same PDB: d3fxoa2
    automated match to d3fxja1
    complexed with mn, po4

Details for d3fxoa1

PDB Entry: 3fxo (more details), 2.5 Å

PDB Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Phosphate at 1 mM of Mn2+
PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d3fxoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fxoa1 d.219.1.1 (A:2-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

SCOPe Domain Coordinates for d3fxoa1:

Click to download the PDB-style file with coordinates for d3fxoa1.
(The format of our PDB-style files is described here.)

Timeline for d3fxoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fxoa2