SCOPe 2.04: Domain d4vuba_: 4vub A:

Lineage for d4vuba_ (4vub A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)
   automatically mapped to Pfam PF01845

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)

8. Domain d4vuba_: 4vub A: [24614]
   complexed with cl

Details for d4vuba_

PDB Entry: 4vub, 1.45 Å

PDB Description: ccdb, a topoisomerase poison from escherichia coli

PDB Compounds: (A:) ccdb

SCOPe Domain Sequences for d4vuba_:

Sequence; same for both SEQRES and ATOM records:

>d4vuba_ b.34.6.1 (A:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Timeline for d4vuba_:

• d4vuba_ first appeared (with stable ids) in SCOP 1.55, called d4vub__
  
• d4vuba_ appears in SCOPe 2.03
  
• d4vuba_ appears in SCOPe 2.05
  
• d4vuba_ appears in the current release, SCOPe 2.08