Lineage for d3ffkd1 (3ffk D:27-152)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665025Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1665042Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries)
    Uniprot P20065 55-179
  8. 1665102Domain d3ffkd1: 3ffk D:27-152 [246112]
    Other proteins in same PDB: d3ffkb1, d3ffkb2, d3ffke1, d3ffke2
    automated match to d1d0na1
    complexed with atp, ca

Details for d3ffkd1

PDB Entry: 3ffk (more details), 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin
PDB Compounds: (D:) plasma gelsolin

SCOPe Domain Sequences for d3ffkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffkd1 d.109.1.1 (D:27-152) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgfkhv

SCOPe Domain Coordinates for d3ffkd1:

Click to download the PDB-style file with coordinates for d3ffkd1.
(The format of our PDB-style files is described here.)

Timeline for d3ffkd1: