Lineage for d3ffkb1 (3ffk B:3-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493339Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries)
  8. 2493357Domain d3ffkb1: 3ffk B:3-146 [246110]
    Other proteins in same PDB: d3ffka1, d3ffka2, d3ffka3, d3ffkb2, d3ffkd1, d3ffkd2, d3ffkd3, d3ffke2
    automated match to d1c0fa1
    complexed with atp, ca

Details for d3ffkb1

PDB Entry: 3ffk (more details), 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3ffkb1:

Sequence, based on SEQRES records: (download)

>d3ffkb1 c.55.1.0 (B:3-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskr
giltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqi
mfetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3ffkb1 c.55.1.0 (B:3-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d3ffkb1:

Click to download the PDB-style file with coordinates for d3ffkb1.
(The format of our PDB-style files is described here.)

Timeline for d3ffkb1: