SCOP 1.65: Domain d1bkb_1: 1bkb 4-74

Lineage for d1bkb_1 (1bkb 4-74)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.34: SH3-like barrel [50036] (13 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (2 proteins)

6. Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (3 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [50113] (1 PDB entry)

8. Domain d1bkb_1: 1bkb 4-74 [24609]
   Other proteins in same PDB: d1bkb_2
   CASP3
   mutant

Details for d1bkb_1

PDB Entry: 1bkb, 1.75 Å

PDB Description: initiation factor 5a from archebacterium pyrobaculum aerophilum

SCOP Domain Sequences for d1bkb_1:

Sequence; same for both SEQRES and ATOM records:

>d1bkb_1 b.34.5.2 (4-74) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum}
kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl
slpvdaqvevp

Timeline for d1bkb_1:

• d1bkb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bkb_1 appears in SCOP 1.63
  
• d1bkb_1 appears in SCOP 1.67
  
• d1bkb_1 appears in the current release, SCOPe 2.08, called d1bkba1