![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
![]() | Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [50113] (1 PDB entry) |
![]() | Domain d1bkba1: 1bkb A:4-74 [24609] Other proteins in same PDB: d1bkba2 CASP3 |
PDB Entry: 1bkb (more details), 1.75 Å
SCOPe Domain Sequences for d1bkba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkba1 b.34.5.2 (A:4-74) Eukaryotic initiation translation factor 5a (eIF5a) {Pyrobaculum aerophilum [TaxId: 13773]} kwvmstkyveagelkegsyvvidgepcrvveieksktgkhgsakarivavgvfdggkrtl slpvdaqvevp
Timeline for d1bkba1: