![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (10 species) not a true protein |
![]() | Species Human herpesvirus 4 (strain b95-8) [TaxId:10377] [255828] (1 PDB entry) |
![]() | Domain d3fd4a_: 3fd4 A: [246089] automated match to d1kg0c_ |
PDB Entry: 3fd4 (more details), 2.4 Å
SCOPe Domain Sequences for d3fd4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fd4a_ d.169.1.1 (A:) automated matches {Human herpesvirus 4 (strain b95-8) [TaxId: 10377]} ptlhtfqvpqnytkanctycntreytfsykgccfyftkkkhtwngcfqacaelypctyfy gptpdilpvvtrnlnaieslwvgvyrvgegnwtsldggtfkvyqifgshctyvskfstvp vshhecsflkpclcvsqrsn
Timeline for d3fd4a_: