Lineage for d3f46a2 (3f46 A:243-345)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334607Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein)
    dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains
    automatically mapped to Pfam PF03201
  6. 2334608Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species)
  7. 2334609Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (6 PDB entries)
    Uniprot Q58194 243-344
  8. 2334614Domain d3f46a2: 3f46 A:243-345 [246025]
    Other proteins in same PDB: d3f46a1
    automated match to d3f47a2
    complexed with cmo, dtv, fe2, i2c

Details for d3f46a2

PDB Entry: 3f46 (more details), 1.95 Å

PDB Description: the crystal structure of c176a mutated [fe]-hydrogenase (hmd) holoenzyme from methanocaldococcus jannaschii
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3f46a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f46a2 a.100.1.11 (A:243-345) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi
anmeealdpaallgtadsmcfgplaeilptalkvlekhkvvee

SCOPe Domain Coordinates for d3f46a2:

Click to download the PDB-style file with coordinates for d3f46a2.
(The format of our PDB-style files is described here.)

Timeline for d3f46a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f46a1