SCOPe 2.08: Domain d3f1va1: 3f1v A:1-122

Lineage for d3f1va1 (3f1v A:1-122)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255692] (2 PDB entries)

8. Domain d3f1va1: 3f1v A:1-122 [246018]
   automated match to d4k3la1
   complexed with ca, cl; mutant

Details for d3f1va1

PDB Entry: 3f1v, 1.77 Å

PDB Description: e. coli beta sliding clamp, 148-153 ala mutant

PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3f1va1:

Sequence; same for both SEQRES and ATOM records:

>d3f1va1 d.131.1.0 (A:1-122) automated matches {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d3f1va1:

• d3f1va1 first appeared in SCOPe 2.04
  
• d3f1va1 appears in SCOPe 2.07