Lineage for d3f1va1 (3f1v A:1-122)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670188Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1670189Protein automated matches [226907] (12 species)
    not a true protein
  7. 1670202Species Escherichia coli [TaxId:562] [255692] (2 PDB entries)
  8. 1670203Domain d3f1va1: 3f1v A:1-122 [246018]
    automated match to d4k3la1
    complexed with ca, cl; mutant

Details for d3f1va1

PDB Entry: 3f1v (more details), 1.77 Å

PDB Description: e. coli beta sliding clamp, 148-153 ala mutant
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3f1va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f1va1 d.131.1.0 (A:1-122) automated matches {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

SCOPe Domain Coordinates for d3f1va1:

Click to download the PDB-style file with coordinates for d3f1va1.
(The format of our PDB-style files is described here.)

Timeline for d3f1va1: