Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (12 species) not a true protein |
Species Escherichia coli [TaxId:562] [255692] (2 PDB entries) |
Domain d3f1va1: 3f1v A:1-122 [246018] automated match to d4k3la1 complexed with ca, cl; mutant |
PDB Entry: 3f1v (more details), 1.77 Å
SCOPe Domain Sequences for d3f1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f1va1 d.131.1.0 (A:1-122) automated matches {Escherichia coli [TaxId: 562]} mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld dw
Timeline for d3f1va1: