| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
| Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89653] (4 PDB entries) |
| Domain d3exfh1: 3exf H:1-191 [245938] Other proteins in same PDB: d3exfa1, d3exfa2, d3exfb2, d3exfc1, d3exfc2, d3exfd2, d3exfe1, d3exfe2, d3exff2, d3exfg1, d3exfg2, d3exfh2 automated match to d2ozlb1 complexed with k, mg, tpp |
PDB Entry: 3exf (more details), 3 Å
SCOPe Domain Sequences for d3exfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exfh1 c.36.1.7 (H:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppeaqskdf
Timeline for d3exfh1: