Lineage for d3eivb_ (3eiv B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059459Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2059651Protein automated matches [190206] (9 species)
    not a true protein
  7. 2059719Species Streptomyces coelicolor [TaxId:1902] [255819] (1 PDB entry)
  8. 2059721Domain d3eivb_: 3eiv B: [245871]
    automated match to d1ue1b_

Details for d3eivb_

PDB Entry: 3eiv (more details), 2.14 Å

PDB Description: Crystal Structure of Single-stranded DNA-binding protein from Streptomyces coelicolor
PDB Compounds: (B:) Single-stranded DNA-binding protein 2

SCOPe Domain Sequences for d3eivb_:

Sequence, based on SEQRES records: (download)

>d3eivb_ b.40.4.3 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
magetvitvvgnlvddpelrftpsgaavakfrvastprtfdrqtnewkdgeslfltcsvw
rqaaenvaeslqrgmrvivqgrlkqrsyedregvkrtvyeldvdevgaslrsatakvtkt

Sequence, based on observed residues (ATOM records): (download)

>d3eivb_ b.40.4.3 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
magetvitvvgnlvddpelrftpsgaavakfrvastprtdgeslfltcsvwrqaaenvae
slqrgmrvivqgrlkqrsyedregvkrtvyeldvdevgaslrsatakvtkt

SCOPe Domain Coordinates for d3eivb_:

Click to download the PDB-style file with coordinates for d3eivb_.
(The format of our PDB-style files is described here.)

Timeline for d3eivb_: