Lineage for d3edea1 (3ede A:3-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376155Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)
  8. 2376160Domain d3edea1: 3ede A:3-95 [245831]
    Other proteins in same PDB: d3edea2, d3edea3, d3edeb2, d3edeb3
    automated match to d1h3ga1
    complexed with ca, gol

Details for d3edea1

PDB Entry: 3ede (more details), 1.71 Å

PDB Description: structural base for cyclodextrin hydrolysis
PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3edea1 b.1.18.0 (A:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

SCOPe Domain Coordinates for d3edea1:

Click to download the PDB-style file with coordinates for d3edea1.
(The format of our PDB-style files is described here.)

Timeline for d3edea1: