![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries) |
![]() | Domain d1mmg_1: 1mmg 34-79 [24579] Other proteins in same PDB: d1mmg_2 |
PDB Entry: 1mmg (more details), 1.9 Å
SCOP Domain Sequences for d1mmg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmg_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)} yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq
Timeline for d1mmg_1: