Lineage for d1mmg_1 (1mmg 34-79)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13205Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 13206Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 13207Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 13229Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)
  8. 13233Domain d1mmg_1: 1mmg 34-79 [24579]
    Other proteins in same PDB: d1mmg_2

Details for d1mmg_1

PDB Entry: 1mmg (more details), 1.9 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1mmg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmg_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOP Domain Coordinates for d1mmg_1:

Click to download the PDB-style file with coordinates for d1mmg_1.
(The format of our PDB-style files is described here.)

Timeline for d1mmg_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmg_2