SCOP 1.57: Domain d1mmg_1: 1mmg 34-79

Lineage for d1mmg_1 (1mmg 34-79)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)

8. Domain d1mmg_1: 1mmg 34-79 [24579]
   Other proteins in same PDB: d1mmg_2

Details for d1mmg_1

PDB Entry: 1mmg, 1.9 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1mmg_1:

Sequence; same for both SEQRES and ATOM records:

>d1mmg_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

Timeline for d1mmg_1:

• d1mmg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1mmg_1 appears in SCOP 1.59
  
• d1mmg_1 appears in the current release, SCOPe 2.08, called d1mmga1