Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) |
Domain d1voma1: 1vom A:34-79 [24577] Other proteins in same PDB: d1voma2 complexed with adp, mg, vo4 |
PDB Entry: 1vom (more details), 1.9 Å
SCOPe Domain Sequences for d1voma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1voma1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1voma1: