Lineage for d1voma2 (1vom A:2-33,A:80-747)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111685Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (18 PDB entries)
  8. 2111688Domain d1voma2: 1vom A:2-33,A:80-747 [32174]
    Other proteins in same PDB: d1voma1
    complexed with adp, mg, vo4

Details for d1voma2

PDB Entry: 1vom (more details), 1.9 Å

PDB Description: complex between dictyostelium myosin and mgadp and vanadate at 1.9a resolution
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1voma2:

Sequence, based on SEQRES records: (download)

>d1voma2 c.37.1.9 (A:2-33,A:80-747) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryy
llapnvprdaedsqkatdavlkhlnidpeqyrfgitkiffr

Sequence, based on observed residues (ATOM records): (download)

>d1voma2 c.37.1.9 (A:2-33,A:80-747) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqgvleqqilqanpileafgnakt
trnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagata
eekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiag
ilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhln
vekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlc
inytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalld
eqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkd
plqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnp
hfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllap
vprdqkatnidpeqyrfgitkiffr

SCOPe Domain Coordinates for d1voma2:

Click to download the PDB-style file with coordinates for d1voma2.
(The format of our PDB-style files is described here.)

Timeline for d1voma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1voma1