SCOPe 2.04: Domain d3e2pb1: 3e2p B:1-147

Lineage for d3e2pb1 (3e2p B:1-147)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [255807] (1 PDB entry)

8. Domain d3e2pb1: 3e2p B:1-147 [245769]
   automated match to d2be7a1
   complexed with so4

Details for d3e2pb1

PDB Entry: 3e2p, 3 Å

PDB Description: Catalytic subunit of M. Jannaschii aspartate transcarbamoylase in an orthorhombic crystal form

PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3e2pb1:

Sequence; same for both SEQRES and ATOM records:

>d3e2pb1 c.78.1.0 (B:1-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreig

Timeline for d3e2pb1:

• d3e2pb1 is new in SCOPe 2.04-stable
  
• d3e2pb1 appears in SCOPe 2.05
  
• d3e2pb1 appears in the current release, SCOPe 2.08