Class b: All beta proteins [48724] (126 folds) |
Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (3 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries) |
Domain d1dfla1: 1dfl A:29-76 [24574] Other proteins in same PDB: d1dfla2, d1dflb2, d1dflw_, d1dflx_, d1dfly_, d1dflz_ |
PDB Entry: 1dfl (more details), 4.2 Å
SCOP Domain Sequences for d1dfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfla1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)} dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1dfla1: